Recombinant human il-23 protein
WebbInterleukin 23 (IL-23) is a member of the IL-12 family of cytokines, and it is comprised of two subunits, p19 and p40. The p19/p40 heterodimer is stabilized by a disulfide bond. … WebbIt is recommended to reconstitute the protein in sterile PBS containing 0.1% endotoxin-free recombinant human serum albumin. Stability & Storage. Use a manual defrost freezer …
Recombinant human il-23 protein
Did you know?
Webb21 mars 2024 · GeneCards Summary for IL23A Gene. IL23A (Interleukin 23 Subunit Alpha) is a Protein Coding gene. Diseases associated with IL23A include Multiple Sclerosis and … WebbRecombinant Human IL-23 is a heterodimeric protein consisting of the two subunits, p19 (170 amino acids) and p40 (306 amino acids). Associated products Specifications …
WebbVHL Protein Complex, Active, 10 µg Active complex of five (5) recombinant human enzymes: VHL amino acids 54-end, full length Elongin C, full length Elongin B, full length … WebbHuman IL-23 ELISA Kit Reactivity: Human Sample type: Serum, Cell culture media, Hep Plasma, EDTA Plasma, Cit plasma Compare (max 4) (3) Anti-IL-23 antibody [HLT2736] (ab110630) Specific References (1) Description: Mouse monoclonal [HLT2736] to IL-23 Application: IHC-P, WB Reactivity: Human, Recombinant fragment Conjugate: …
WebbThe purpose of this study was to investigate the antibody responses induced by LSA and recombinant kinetoplastid membrane protein 11 (rKMP11) in serum samples from healthy and sick dogs by in house enzyme-linked immunosorbent assay (ELISA) and the effects of LSA and rKMP11 antigens on the ex vivo induction of specific IFN-γ cytokine responses … WebbRecombinant Human IL-23 Protein (Met1-Ser328 & Arg20-Pro189) CT048-H08H with a fusion His Tag, is expressed in HEK293 Cells. With high purity, high biological activity, …
WebbProduct Description: Human IL11 (P20809, 23 a.a. - 199 a.a.) partial recombinant protein expressed in Escherichia coli . Sequence: GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL Host: Escherichia coli
WebbIL-23 alpha (170a.a) & IL-12 beta (306a.a) Heterodimer Protein, Human is produced in HEK293 cells, with total length of 476 amino acids and a C-Terminal His- and Avi-tag. IL … upcoming public holidays sydneyWebbGibco™ Human FGF-23 Protein, PeproTech®, Catalog # 100 ... Recombinant Human FGF-23 is a 25.5 kDa globular ... positive regulation of ERK1 and ERK2 cascade cellular response to vitamin D cellular response to interleukin-6 cellular response to parathyroid hormone stimulus positive regulation of MAPKKK cascade by fibroblast ... rectangular gray outdoor umbrellaWebb26 aug. 2024 · Interleukin (IL)-23 is considered an effective therapeutic target for the treatment of psoriasis because of the crucial role of the IL-23/IL-17 axis in the … upcoming rappers ukWebbIL-23 stands for interleukin 23. Human IL-23 is a recombinant protein optimized for use in cell culture, differentiation studies, and functional assays. Choose your product. Select a … upcoming punk shows near meWebbIL-33 (Interleukin-33, NF-HEV) is a nuclear cytokine that is part of the IL-1 family (1,2). Originally discovered as the ‘nuclear factor from high endothelial venules,’ it is widely … upcoming radiohead concertsWebbHuman IL 23 Recombinant Protein: Product Code: RPPB0643: Size: 10µg: Species: Human: Target: IL 23: Synonyms: Interleukin 23 alpha subunit p19, Interleukin-12 subunit beta … rectangular head t-boltWebbRecombinant Human IL-23 Protein Recombinant Human IL-23 Protein Summary. Measured by its ability to induce IL-17 secretion by mouse splenocytes. Complete Your Research. Complete Your Experiment. Product Datasheets. Carrier Free. What does CF mean? CF … upcoming racing games 2019 ps4