Lysm domain-containing gpi-anchored protein
Web10 apr. 2024 · The N-terminal Fr domain contains very few folate-binding sites; the following LRR region is a Slit2-type LRR, and a GPI-anchored site was predicted at the C-terminus. RT-PCR analysis showed FrLRR is a transcription-mediated fusion gene of BbFR-like and BbSlit2-N-like genes. ... Leucine-rich repeat and fibronectin type-III domain-containing ... Web11 mar. 2024 · The protein moiety of GPI-APs lacking transmembrane domains is anchored to the plasma membrane with GPI covalently attached to the C-terminus. The GPI consists of the conserved core glycan, phosphatidylinositol and glycan side chains. The entire GPI-AP is anchored to the outer leaflet of the lipid bilayer by insertion of fatty …
Lysm domain-containing gpi-anchored protein
Did you know?
Web10 apr. 2024 · Background Glycosylphosphatidylinositol (GPI) and GPI-anchored proteins (GAPs) are important for cell wall formation and reproductive development in Arabidopsis. However, monocot counterparts that function in kernel endosperm development have yet to be discovered. Here, we performed a multi-omic analysis to explore the function of GPI … Web1 aug. 2016 · Furthermore, Arabidopsis CERK1 is also recruited by the orthologues of rice LYP4 and LYP6, LysM DOMAIN-CONTAINING GPI-ANCHORED PROTEIN 1 (LYM1) and LYM3 during peptidoglycan recognition to mediate ...
Web10 apr. 2024 · LYP2; lysm domain GPI-anchored protein 1 precursor; LysM-containing receptor protein 2; T26F17.10; T26F17_10 Summary Encodes a lysin-motif protein … WebThe carboxyl-terminal signal peptide containing hydrophobic tail is characterized by genetic analysis and shown to be essential for GPI modification of protein. Recent computational analysis further clarified the detailed requirement of the carboxyl-terminal regions for GPI-anchoring. GPI-anchored proteins are assumed to be transported from ...
WebGene ID: 104807395, updated on 5-Sep-2024. Summary Other designations. lysM domain-containing GPI-anchored protein 2 WebFirst characterized approximately 20 years ago, the glycosylphosphatidylinositol (GPI1) anchor is a glycolipid structure that is added posttranslationally to the C-terminus of many eukaryotic proteins .This modification anchors the attached protein in the outer leaflet of the cell membrane .Proteins containing a GPI anchor are functionally diverse and play …
Web11 apr. 2024 · The COBRA gene encodes a plant-specific glycosylphosphatidylinositol (GPI)-anchored protein (GAP), which plays an important role in cell wall cellulose deposition. In this study, a total of 7 COBRA-like (COBL) genes were identified in the genome of the rare and endangered woody plant Liriodendron chinense (L. chinense). …
WebAnnotation: LYP2 locus:2201143 AT1G21880 AT1G21880 LYM1 LYP2 lysm domain GPI-anchored protein 1 precursor LysM-containing receptor protein 2 T26F17.10 T26F17_10 homemade onion ring batterWeb23 sept. 2008 · BIG-PI is the first publicly released method for GPI-anchor prediction, and the predictions are made by four kingdom-specific predictors [ 10, 12, 13 ]. This method is able to recognize only half of the submitted GPI-anchored proteins while maintaining a false positive rate as low as 0.3%. homemade onion sauce recipeWebThe most common extracellular ligand-binding domain found in RLPs is LRRs (Figure 1) [].There are about 223 LRR-RLKs and 57 LRR-RLPs in Arabidopsis [4, 7, 10, 11].In LRR-RLKs, the intracellular kinase domain exhibits more conservation than the extracellular LRR domain [].A quantification of the number of LRRs in Arabidopsis LRR-RLKs reveals a … homemade onion ring dipping sauceWebgenome browser: aa seq: 407 aa aa seq db search mptpatalllflaaaaaafrgatakttiepcagadacpallgytlyadmkvsevaalfga dpaavlaanaldfaspgaanrilpkgtplrvptrcacadgvrksvavryaarpsdtlgsi homemade onion ring batter mixWebProtein target information for LysM domain-containing GPI-anchored protein LYP4 (Japanese rice). Find diseases associated with this biological target and compounds … homemade onion rings with buttermilkWebGlycosylphosphatidylinositol (pronunciation (help · info)), or glycophosphatidylinositol, or GPI in short, is a phosphoglyceride that can be attached to the C-terminus of a protein during posttranslational modification.The resulting GPI-anchored proteins play key roles in a wide variety of biological processes. GPI is composed of a phosphatidylinositol group … homemade onion soup recipesWeb1 sept. 2024 · A total of 14 LysM domain-containing proteins, five as LYK and nine as LysM, have been reported in arabidopsis (Shinya et al., 2012). Similarly, 10 and 7 as … homemade oral rehydration solutions